DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG17572

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:267 Identity:59/267 - (22%)
Similarity:98/267 - (36%) Gaps:58/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGF------SGGWWCGGSIIAHDWVLTAEHC------------- 81
            :||....|.    |..|:...:||      :..:.|.|::||...:|||.||             
  Fly   129 VQGHFYKGL----GSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSV 189

  Fly    82 -IG------DADSVTVYFGATWRTNAQFTHWVGNGNFIK---HSSADIALIRIPHVDFWHMVNKV 136
             :|      |.|.....|.|....|...:|.:.:.::.:   |....:.:::.|   ..:.|...
  Fly   190 RVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTP---LNYSVATQ 251

  Fly   137 ELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTP 201
            .:.....|.|......|...|||.....|.....:..:|:.:.....|...|||.|    .:.:|
  Fly   252 PICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTG----ALESP 312

  Fly   202 ------------DGKSTCGGDSGGPL-VTHDGT-KLVGVTNFGS--VAGCQSGAPAGFQRVTYHL 250
                        :||..|.|..|.|| :..:|. ..:|:.:|||  ..|.:  .|:.:..|.:..
  Fly   313 NSIEGQWMCAGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLR--IPSVYTSVAHFS 375

  Fly   251 DWIRDHT 257
            :||.|:|
  Fly   376 EWIHDNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/258 (21%)
Tryp_SPc 40..256 CDD:238113 55/260 (21%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 54/251 (22%)
Tryp_SPc 138..378 CDD:214473 52/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.