DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG4650

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:252 Identity:54/252 - (21%)
Similarity:93/252 - (36%) Gaps:58/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGYPAEEGKAPYTVGLGFSGGWW-CGGSIIAHDWVLTAEHCIGDADSVTVYFG-------- 93
            |.:|||..|....:|:...|..|...: |||::|....||||.||...::.:....|        
  Fly    29 GLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDA 93

  Fly    94 -----ATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWW 152
                 :.::.:..|.|.:.|   ...|:.|||::.: ..:.|...:..:.:           .||
  Fly    94 NDTMLSEYQVSQTFIHSLYN---TTTSANDIAILGLATDIVFSKTIRPICI-----------VWW 144

  Fly   153 AV------------ACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCVRTPDGK 204
            .:            ...||...|.:. .|..:..|::....:.||...| ::..:..|....|.|
  Fly   145 TIWRKYIDNIQVLSGAQWGLPNDRNE-SDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSK 208

  Fly   205 STCGGDSGGPL---VTHDGTK---LVGV--TNFGSVAGCQSGAPAGFQRVTYHLDWI 253
             .|..|...||   :|....:   |:|:  ||    ..|:..:.  :..|..|.|:|
  Fly   209 -LCNVDFSSPLGAIITFKNIQRYVLIGIATTN----QKCKRASV--YTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 52/249 (21%)
Tryp_SPc 40..256 CDD:238113 53/250 (21%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 51/246 (21%)
Tryp_SPc 33..258 CDD:304450 51/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.