DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Phae1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:274 Identity:77/274 - (28%)
Similarity:117/274 - (42%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIA 71
            :|.|.:...||..:.       .|      :||:..|.||....|||.|.:.:.|..:|..||:.
  Fly    16 LLLLGICRISGVAIG-------AP------EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILN 67

  Fly    72 HDWVLTAEHCIGD----------ADSVTVYFGATWRTNAQFTHWVGN----GNFIKHSSADIALI 122
            .:|::||.||:.:          |.|:.|...|:.......|::|.|    |..:.:   ||.:|
  Fly    68 ANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPY---DIGMI 129

  Fly   123 RIPHVDFWH-MVNKVELPSY----NDRYNDYNEWWAVACGWG--GTYDGSPLPDYLQ-CVDLQII 179
            ..|....|. .|..|.|||.    ....|.|        |||  .|.:.:..|..|| ..::.||
  Fly   130 YTPTAFVWSAAVAPVTLPSSGVVPTGTANLY--------GWGSTSTTNTASYPSTLQVATNVPII 186

  Fly   180 HNSECSGYYGSVGDNI----LCV-RTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGA 239
            ..|.|....|:.|.::    ||. ....|.|.|..|||||||  .|..|:|:.::|.:...|:.:
  Fly   187 SLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLV--QGNVLIGIVSWGKLPCGQANS 249

  Fly   240 PAGFQRVTYHLDWI 253
            |:.:.:|:..:.||
  Fly   250 PSVYVQVSSFISWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/240 (29%)
Tryp_SPc 40..256 CDD:238113 70/241 (29%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 69/240 (29%)
Tryp_SPc 36..266 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.