DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and TMPRSS7

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:245 Identity:69/245 - (28%)
Similarity:108/245 - (44%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC-----IGDADSVTVYFGATWRT 98
            ||..|....||..|:.|.|.|.|..:||.|:|:.:|:|:|.||     :.|....|.:.|...:.
Human   605 RIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQG 669

  Fly    99 NAQF--------THWVGNGNFIKHSSADIALIRIPHVDFW-----HMVNKVELPSYNDRYNDYNE 150
            ||:|        .|...|.....:   ||||:::...  |     .::..:.:|....|.....:
Human   670 NAKFVSPVRRIVVHEYYNSQTFDY---DIALLQLSIA--WPETLKQLIQPICIPPTGQRVRSGEK 729

  Fly   151 WWAVACGWGGTYD----GSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGK-STCGGD 210
            .|..  |||..::    ||.:   ||..::::|..:.|...||.:...:||.....|| ..|.||
Human   730 CWVT--GWGRRHEADNKGSLV---LQQAEVELIDQTLCVSTYGIITSRMLCAGIMSGKRDACKGD 789

  Fly   211 SGGPLVTH---DGT-KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256
            |||||...   ||. .|.|:.::|..:| :...|..:.||:..:.||..:
Human   790 SGGPLSCRRKSDGKWILTGIVSWGHGSG-RPNFPGVYTRVSNFVPWIHKY 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/240 (28%)
Tryp_SPc 40..256 CDD:238113 68/242 (28%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.