DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and OVCH2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:288 Identity:81/288 - (28%)
Similarity:123/288 - (42%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSII 70
            |.|:|..|.:.|.::     .|:.|.:..::..||..|...|:|..|:.|.|.......|||||:
Human    27 ATLSLPKAPSCGQSL-----VKVQPWNYFNIFSRILGGSQVEKGSYPWQVSLKQRQKHICGGSIV 86

  Fly    71 AHDWVLTAEHCIGDADSVTVY------FGATWRTNAQFTHWVGNGNFIKHSSA------DIALIR 123
            :..||:||.|||.:.:.|:..      :..:.....:.|..:.......|.|.      ||||::
Human    87 SPQWVITAAHCIANRNIVSTLNVTAGEYDLSQTDPGEQTLTIETVIIHPHFSTKKPMDYDIALLK 151

  Fly   124 IPHV-DFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGY 187
            :... .|.|.|..:.||...:::.  ..:.....|||...:|..|...||.|:|.|:...||...
Human   152 MAGAFQFGHFVGPICLPELREQFE--AGFICTTAGWGRLTEGGVLSQVLQEVNLPILTWEECVAA 214

  Fly   188 YGSV-----GDNILCVRTPD-GKSTCGGDSGGPLVTHD---GTKLVGVTNFGSVAGC-------- 235
            ..::     |...||...|| |:..|.|||||.|:..:   ...|.|||::|  .||        
Human   215 LLTLKRPISGKTFLCTGFPDGGRDACQGDSGGSLMCRNKKGAWTLAGVTSWG--LGCGRGWRNNV 277

  Fly   236 ---QSGAPAGFQRVTYHLDWIRDH--TG 258
               ..|:|..|..::..|.||.:|  ||
Human   278 RKSDQGSPGIFTDISKVLPWIHEHIQTG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/246 (28%)
Tryp_SPc 40..256 CDD:238113 70/248 (28%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 69/246 (28%)
Tryp_SPc 56..301 CDD:238113 70/248 (28%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.