DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG31954

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:257 Identity:80/257 - (31%)
Similarity:124/257 - (48%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI--GDADSVT 89
            ||:|    .:.|||..|:......||:.|.|..| ...||||||:.:|:|||.||.  ..||.:.
  Fly    42 KLSP----RLDGRIVGGHRINITDAPHQVSLQTS-SHICGGSIISEEWILTAAHCTYGKTADRLK 101

  Fly    90 VYFGATWRT-------------NAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELPS 140
            |..|.:...             :|||.:        .:...|.:|:::.| :.|......|:||.
  Fly   102 VRLGTSEFARSGQLLRVQKIVQHAQFNY--------TNVDYDFSLLQLAHPIKFDETKKAVKLPE 158

  Fly   141 YNDRYNDYNEWWAVAC---GWGGTYDGSPLPDYLQCVDLQIIHNSECS---GYYGSVGDNILCVR 199
            ...:|.|     ..||   |||.|.:.....::|:.|::.:::...||   ..||.|.:.::|..
  Fly   159 SQMKYMD-----GEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAG 218

  Fly   200 -TPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDHTGI 259
             ...||..|.||||||:|:..| :||||.::|  .|| :...|..:.||::..|||::|:|:
  Fly   219 FLEGGKDACQGDSGGPMVSESG-ELVGVVSWG--YGCAKPDYPGVYSRVSFARDWIKEHSGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/237 (30%)
Tryp_SPc 40..256 CDD:238113 73/239 (31%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 72/237 (30%)
Tryp_SPc 51..274 CDD:238113 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.