DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and prss60.3

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:247 Identity:87/247 - (35%)
Similarity:118/247 - (47%) Gaps:34/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVHTKDMQGRITNGYPAEEGKAPYTVGLGFS--GGWWCGGSIIAHDWVLTAEHCIGDADSVT--V 90
            |::|     ||..|..|..|..|:.|.|...  ||.:||||:|:.:|||||.||:......|  |
Zfish    31 PLNT-----RIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVV 90

  Fly    91 YFGATWRTNAQFTHWVGNGNFIK---HSS-------ADIALIRIPH-VDFWHMVNKVELPSYNDR 144
            |.|.  ||......:..:.|..|   |||       .||||:|:.. |.|.:.:..|.|.:.|..
Zfish    91 YLGR--RTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSV 153

  Fly   145 YNDYNEWWAVACGWGGTYDG--SPLPDYLQCVDLQIIHNSECSGYYGS--VGDNILCV-RTPDGK 204
            |:.....|..  |||....|  .|.|..||...:.::.|..|:...||  |.:|::|. .|..||
Zfish   154 YSAGTSSWIT--GWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQGGK 216

  Fly   205 STCGGDSGGPLVTHDGTKLV--GVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            .||.||||||:||...|..|  |:|::|  .|| ...:|..:.||:.:..||
Zfish   217 DTCQGDSGGPMVTRLCTVWVQAGITSWG--YGCADPNSPGVYTRVSQYQSWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 83/236 (35%)
Tryp_SPc 40..256 CDD:238113 84/237 (35%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 84/237 (35%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.