DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CLIPC1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_552698.3 Gene:CLIPC1 / 3291827 VectorBaseID:AGAP008835 Length:389 Species:Anopheles gambiae


Alignment Length:298 Identity:77/298 - (25%)
Similarity:117/298 - (39%) Gaps:71/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASGATMPRLATEKLTPVHTKDMQGR-----ITNGYPAEEGKAPYTVGLGFSGG--- 62
            |:.:....::..|:.|:|        .|.|..|.     |.:|..|:..:.|:...:||...   
Mosquito   112 AVFSKEYVNSLTASEPKL--------QTIDKCGHTAVELIVDGELAKAREFPHMALIGFGEAPEI 168

  Fly    63 -WWCGGSIIAHDWVLTAEHCIGDADSVTVYFG-ATWRTNAQFTHWVGNGNFIKHSSADIAL---- 121
             :.||||:::..::|||.||:     .:..|| ||         .|..|.....||.|.|.    
Mosquito   169 RYLCGGSLVSDRFILTAGHCL-----TSTNFGPAT---------IVRLGELSLASSTDEAFPEDY 219

  Fly   122 ---IRIPHVDFWHM--VNKVELPSYNDR--YNDY------------NEWWAVACGWGGTYDGSPL 167
               .||||.::...  .|.:.|...|.:  ::.|            .:..|:|.|||....|...
Mosquito   220 DIAERIPHPEYKQTSHYNDIALIKLNRKVIFSPYARPICLPLQAAIPQKRAIATGWGAIGFGLEQ 284

  Fly   168 PDYLQCVDLQIIHNSECSGYY--------GSVGDNILCVRTPDG-KSTCGGDSGGPLVTHDGTK- 222
            ...|..|.|.:....||...:        |......||..:.:. |.||.|||||||..::... 
Mosquito   285 SSALLKVTLDMFRFEECKDQFEPTRKLRTGLNATTQLCAGSRNSTKDTCQGDSGGPLQVYNDANV 349

  Fly   223 -----LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255
                 ::|||:||...|. :|.||.:..|..:|.||.:
Mosquito   350 YCTYTIIGVTSFGQNCGL-AGVPAVYTTVYSYLSWIEN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/261 (26%)
Tryp_SPc 40..256 CDD:238113 70/259 (27%)
CLIPC1XP_552698.3 CLIP 39..79 CDD:197829
Tryp_SPc 143..386 CDD:238113 70/257 (27%)
Tryp_SPc 143..384 CDD:214473 68/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.