DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:250 Identity:67/250 - (26%)
Similarity:109/250 - (43%) Gaps:47/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVHTKDMQGRITNGYPAEEGKAPYTVGLGFS-GGWWCGGSIIAHDWVLTAEHCI-GDADSVTV-- 90
            |.......|||..|..|..|.||:.|.|..| ....|||:::::.:||::.:|: |...:.|:  
Mosquito    14 PAFAAGPNGRIVGGIDAVAGDAPWMVSLRNSINQHLCGGTLLSNRFVLSSANCLSGRLATATMAV 78

  Fly    91 ------------YFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYND 143
                        |:|....|:..|     |.|.::|   |:||.:.. :.|....:...||...|
Mosquito    79 AGSRFLNTAAIPYYGIQIITHPNF-----NVNTLEH---DVALFQTA-LQFILTQSVQPLPLSAD 134

  Fly   144 ------RYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS----VGDNILCV 198
                  |        |...|||.:.......:.||.:::..:.|.:|:.:.|:    :|.:.||.
Mosquito   135 VIGVGVR--------ARVFGWGASQANGGNTNALQFLNVNTLSNDDCANFLGAEGWRIGPSSLCT 191

  Fly   199 RTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            .|.:|:..||||.||.||..:  ..:||.::|  ..|.:|.|..|.|::....||
Mosquito   192 LTREGQGICGGDEGGALVLDN--YAIGVASWG--IPCATGRPDVFVRISAVRSWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/239 (26%)
Tryp_SPc 40..256 CDD:238113 63/239 (26%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 63/239 (26%)
Tryp_SPc 24..242 CDD:238113 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.