DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP011914

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_552329.3 Gene:AgaP_AGAP011914 / 3291452 VectorBaseID:AGAP011914 Length:398 Species:Anopheles gambiae


Alignment Length:299 Identity:83/299 - (27%)
Similarity:118/299 - (39%) Gaps:63/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW--- 63
            |..:|:|. :.:::.|....::...||.....:.....|.||:|....:.|...||     |   
Mosquito   121 KLVVALLG-STSTSGGRFRCQITALKLACDCGRHRTPTIVNGFPTLTNEYPMMAGL-----WDNS 179

  Fly    64 ----WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGN-------------- 110
                :||.:|:.:..||||.||:.|            ||.|.....||..|              
Mosquito   180 VSRVFCGSTIVTNRHVLTAAHCLLD------------RTAAGTRVLVGEQNTNITNETPYTLRML 232

  Fly   111 ---FIKHSS-------ADIALIR-IPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDG 164
               ||||.|       .||||:: ...:.|...|.:|.|| :....:.:......|.|||....|
Mosquito   233 VSTFIKHPSYNPTSKANDIALVQTFDTIVFNPGVGRVCLP-FRFGTSSFENARLSALGWGAIDFG 296

  Fly   165 SPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRT---PDGKSTCGGDSGGPL-VTHDGTKLV- 224
            :|....|....|.::.::.|.   ..:...||..:.   ..|..||..|||||| .|...::|| 
Mosquito   297 APSSKELLQTTLAVVSSTSCG---TKLSRTILASQMCTFAAGNDTCQNDSGGPLYYTDPNSQLVY 358

  Fly   225 --GVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGIAY 261
              ||..||  ..|.|..|:...|||.:||||...||..:
Mosquito   359 SIGVVGFG--VACASSFPSVNTRVTSYLDWISSTTGYTF 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/252 (29%)
Tryp_SPc 40..256 CDD:238113 75/254 (30%)
AgaP_AGAP011914XP_552329.3 CUB 34..143 CDD:238001 4/22 (18%)
Tryp_SPc 158..390 CDD:238113 75/254 (30%)
Tryp_SPc 158..387 CDD:214473 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.