DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP003627

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_562493.4 Gene:AgaP_AGAP003627 / 3290876 VectorBaseID:AGAP003627 Length:310 Species:Anopheles gambiae


Alignment Length:245 Identity:69/245 - (28%)
Similarity:116/245 - (47%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVG 107
            |||.::|:..|        .:.|||::|::..:|||.||..:.|.|.|..| .:.|.::     .
Mosquito    80 GYPKKDGEKGY--------DFLCGGTLISNQHILTAAHCFNEGDPVIVRVG-EYDTKSE-----S 130

  Fly   108 NGNFIKHSSADIALIRIPHVDF-----WHMVNKVEL-----------PS--YNDRYNDYNEWWAV 154
            |..:    .:||..|| .|.|:     :|.:..|:|           |:  ::....:...:.|.
Mosquito   131 NEEY----ESDILSIR-RHQDYLSTRSYHDIALVKLKYPIILSKHIRPACLWDTEERNITRYIAT 190

  Fly   155 ACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS-------VGDNILCVRT-PDGKSTCGGDS 211
            ..|:..|: |:.|...:..|:|.....|:|...:.|       |.|..|||.: .:|:.||.|||
Mosquito   191 GFGYNETF-GTTLSTVMMKVNLDEFPVSDCKRSFKSHPKFRQGVRDGQLCVGSIVEGRDTCQGDS 254

  Fly   212 GGPL--VTHDGT---KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256
            ||||  ||:..:   .:||:|:.|.|.| ...|.|.:.:|::::|||.::
Mosquito   255 GGPLQVVTNPRSCSFAVVGITSIGGVCG-GPNAKAIYTKVSHYIDWIENN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/240 (28%)
Tryp_SPc 40..256 CDD:238113 69/243 (28%)
AgaP_AGAP003627XP_562493.4 Tryp_SPc 62..303 CDD:238113 69/243 (28%)
Tryp_SPc 62..300 CDD:214473 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.