DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and psh

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:113/281 - (40%) Gaps:94/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLG---FSGGWWCGGSIIAHDWVLTAEHCIG-DADS-VTVYFGATWRTN 99
            |..|||.:.|..|:...:|   |...:.||||:||..:||||.||:. ||:: ..|..||....|
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208

  Fly   100 AQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVEL-PSY-NDRYNDY-------------- 148
            ..            ||..||            ::..|:: |.| .::|||.              
  Fly   209 PD------------HSYQDI------------VIRSVKIHPQYVGNKYNDIAILELERDVVETDN 249

  Fly   149 ---------------NEWWAVACGWG----GTYDGSPLPDYLQCVDLQIIHNSECSGYY----GS 190
                           |..:.|| |||    .|...|.:   |....|:::...:|:..|    ||
  Fly   250 IRPACLHTDATDPPSNSKFFVA-GWGVLNVTTRARSKI---LLRAGLELVPLDQCNISYAEQPGS 310

  Fly   191 VG-------DNILCVRTPDGK---STCGGDSGGPLV----THDGT-KLVGVTNFGSVAGCQSGAP 240
            :.       |::||  ..|.|   ..|.|||||||:    ..||. .::||.:.|  .||.:..|
  Fly   311 IRLLKQGVIDSLLC--AIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSG--FGCATVTP 371

  Fly   241 AGFQRVTYHLDWIRDHTGIAY 261
            ..:.||:.:||:|.   ||.:
  Fly   372 GLYTRVSSYLDFIE---GIVW 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/271 (28%)
Tryp_SPc 40..256 CDD:238113 76/274 (28%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 75/271 (28%)
Tryp_SPc 144..387 CDD:238113 76/277 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436973
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.