DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG9676

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:245 Identity:69/245 - (28%)
Similarity:117/245 - (47%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC------IGDADSVTVYFGA 94
            ::.||..|..|.||:.|:.:.|...|...||||||:.|:|:||.||      :..|:.:.:..|:
  Fly    24 VEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGS 88

  Fly    95 TWRTN-------AQFT---HWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELPSY---NDRY 145
            ...::       |..|   ::..||:       |:|::|:.: :.|...:..::|.:.   ||..
  Fly    89 LLLSSGGVRVPVATVTVHPNYNSNGH-------DVAVLRLRNSLTFNSNIAAIKLATEDPPNDAT 146

  Fly   146 NDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC-SGYYGSVGDNILCVRTPDGKSTCGG 209
            .|.:       |||......|:.:.|..|.::.:....| ..|...:.:..:|:..|..|..|.|
  Fly   147 VDIS-------GWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYG 204

  Fly   210 DSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGI 259
            ||||| .|:.| ||||:.:| .:.||...||.|::||:...:||.:...:
  Fly   205 DSGGP-ATYQG-KLVGLASF-VIGGCGRAAPDGYERVSKLRNWIAEKASL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/234 (29%)
Tryp_SPc 40..256 CDD:238113 68/236 (29%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/234 (29%)
Tryp_SPc 28..248 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.