DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG33160

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:99/233 - (42%) Gaps:25/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI--GDADSVTVYFGATWRT 98
            :|.||..|:.:...:..|.|.:..|.. .||||::...||:||.||:  .:.:...:|.||:.:.
  Fly    30 IQPRIIGGHVSSIKEEKYLVQVTTSEE-LCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQA 93

  Fly    99 NAQFTHWVGNGNFI--------KHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVA 155
            .....  :...::|        |..:.|:|.:|:........:..:.|.:.:......    ...
  Fly    94 GPYAV--IRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARAL----VKV 152

  Fly   156 CGWGG-TYDGSPLPDYLQCVDLQIIHNSEC-SGYYG--SVGDNILCVRTPDGKSTCGGDSGGPLV 216
            .|||. |.|.:...:.:..|.:.:...:.| |.:.|  .:..:::|......|.:|.||||||||
  Fly   153 SGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLV 217

  Fly   217 THDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            ...  :|.|:.:||  .||.|..|..:..|....||.:
  Fly   218 YRG--QLAGIVSFG--YGCASALPGIYTSVPEIRDWFQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 55/227 (24%)
Tryp_SPc 40..256 CDD:238113 55/229 (24%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 54/226 (24%)
Tryp_SPc 34..253 CDD:238113 55/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.