DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG31220

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:234 Identity:62/234 - (26%)
Similarity:92/234 - (39%) Gaps:54/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIIAHDWVLTAEHCIGDA--DSVTVYFGATWRTNAQFTHWVGNG---------------NFI 112
            ||||:|...:||||.||:.|.  ....|..|.  .|.:.....:..|               :..
  Fly   139 CGGSLINTRYVLTAAHCVTDTVLQIQRVRLGE--HTTSHNPDCISRGARIVCAPTHLDIDVESIT 201

  Fly   113 KHSS---------ADIALIR----IPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG--GTY 162
            .|:.         .||||:|    :.:...::.:..::.|....::..|      ..|||  |.:
  Fly   202 SHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY------VAGWGKTGMF 260

  Fly   163 D-GSPLPDYLQCVDLQIIHNSECSGYYG--SVGDNI-LCVRTPDGKSTCGGDSGGPLVTHDG--- 220
            | ||.:   |:...:::....|||..|.  ..|... :|....|.:.||.||||.||:...|   
  Fly   261 DTGSKV---LKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSY 322

  Fly   221 ---TKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256
               |.|.|:|::|...| ..|.|:.|.|......|||.|
  Fly   323 ETITFLAGITSYGGPCG-TIGWPSVFTRTAKFYKWIRAH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 58/229 (25%)
Tryp_SPc 40..256 CDD:238113 61/232 (26%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 58/229 (25%)
Tryp_SPc 104..360 CDD:238113 61/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.