DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG8952

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:280 Identity:90/280 - (32%)
Similarity:135/280 - (48%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQ--GRITNGYPAEEGKAPYTVGLGFSGGW---W 64
            :.::.||..|..|        :...|.::..::  .||.:|..|:.|:.|:.|.|. ...|   .
  Fly     9 LMLVLLAAISVVG--------QPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILK-RDAWDDLL 64

  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHS------SADIALIR 123
            ||||||:..|||||.||.....|:.:.||.....||...:...| |.|.|.      :.|::||:
  Fly    65 CGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSN-NIIIHPDYNDKLNNDVSLIQ 128

  Fly   124 IPH-VDFWHMVNKVEL-PSYNDRYNDYNEWWAVACGWGGTYDGSPLPDY---LQCVDLQIIHNSE 183
            :|. :.|...:..::| ..|.|.. ||....|...|:|.|.|  ...||   |....::||.|::
  Fly   129 LPEPLTFSANIQAIQLVGQYGDSI-DYVGSVATIAGFGYTED--EYLDYSETLLYAQVEIIDNAD 190

  Fly   184 CSGYYGS--VGDNILCVRTPDGK--STCGGDSGGPLVTHDGT----KLVGVTNFGSVAGCQSGAP 240
            |...||.  |.|:.:|.:..||.  |||.|||||||:.::.|    :.:|:.:|.:...|....|
  Fly   191 CVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLP 255

  Fly   241 AGFQRVTYHLDWIRDHTGIA 260
            :|:.||:..|.:|.|.||||
  Fly   256 SGYARVSSFLGFIADKTGIA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 79/235 (34%)
Tryp_SPc 40..256 CDD:238113 79/237 (33%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 79/235 (34%)
Tryp_SPc 38..271 CDD:238113 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471049
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.