DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and HPN

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:249 Identity:71/249 - (28%)
Similarity:110/249 - (44%) Gaps:44/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSV----TVYFGATWRTN 99
            ||..|.....|:.|:.|.|.:.|...||||:::.||||||.||..:.:.|    .|:.||..:.:
Human   162 RIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQAS 226

  Fly   100 AQFTHW-----VGNGNFI-------KHSSADIALIR----IPHVDFWHMVNKVELPSYNDRYNDY 148
            ......     |.:|.::       :.:|.||||:.    :|..::   :..|.||:......| 
Human   227 PHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEY---IQPVCLPAAGQALVD- 287

  Fly   149 NEWWAVAC---GWGGTYDGSPLPDYLQCVDLQIIHNSECSG--YYGS-VGDNILCVRTPDGK-ST 206
                ...|   |||.|.........||...:.||.|..|:|  :||: :...:.|...|:|. ..
Human   288 ----GKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDA 348

  Fly   207 CGGDSGGPLVTHDGT------KLVGVTNFGSVAGCQ-SGAPAGFQRVTYHLDWI 253
            |.||||||.|..|..      :|.|:.::|:  ||. :..|..:.:|:...:||
Human   349 CQGDSGGPFVCEDSISRTPRWRLCGIVSWGT--GCALAQKPGVYTKVSDFREWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/247 (28%)
Tryp_SPc 40..256 CDD:238113 70/248 (28%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275
Tryp_SPc 163..400 CDD:238113 68/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.