DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss11b

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:241 Identity:82/241 - (34%)
Similarity:123/241 - (51%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI---GDADSVTVYFGATWRTNA 100
            |||.|..|.:|:.|:...|..:|..:||.|:|...::|||.||.   .:..::||.|| |..|.|
Mouse   184 RITGGSTAHKGEWPWQASLRVNGKHYCGASLIGERFLLTAAHCFQGTNNPKNLTVSFG-TRVTPA 247

  Fly   101 QFTHWVG----NGNFIK--HSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGW 158
            ...|.|.    :.:::|  |.. |:|:|::.. |.|.:.|::|.||.....:....  ..|..||
Mouse   248 YMQHSVQEIIIHEDYVKGEHHD-DVAVIKLTEKVSFNNDVHRVCLPESTQIFPPGE--GVVVTGW 309

  Fly   159 GG-TYDG-SPLPDYLQCVDLQIIHNSECS---GYYGSVGDNILCVRTPDGK-STCGGDSGGPLVT 217
            |. :|:| |||  .||...::||..:.|:   .|.|.:.|.:||....:|. ..|.|||||||| 
Mouse   310 GSFSYNGKSPL--LLQKASIKIIDTNTCNSEEAYGGRIVDTMLCAGYLEGSIDACQGDSGGPLV- 371

  Fly   218 HDGTK----LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGI 259
            |..::    |||:.::|...| :...|..:.|||.:.:||...|||
Mouse   372 HPNSRDIWYLVGIVSWGHECG-RVNKPGVYMRVTSYRNWIASKTGI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 77/233 (33%)
Tryp_SPc 40..256 CDD:238113 78/235 (33%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 77/233 (33%)
Tryp_SPc 185..413 CDD:238113 78/235 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.