DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and spirit

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:262 Identity:71/262 - (27%)
Similarity:104/262 - (39%) Gaps:67/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLGFSGG------WWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRT 98
            :..|.|....:.|:...||:...      :.|||::||:::||||.||   ||     .|....:
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHC---AD-----LGGEPPS 188

  Fly    99 NAQFTHWVGNGNFIKHSSADIALIR-IPHVDFWHMVNKVELPSYNDRYND--------------- 147
            ..:    :|..|.......||::.| |.|.|:          |.:..|||               
  Fly   189 QVR----LGGDNLTLTEGEDISIRRVIIHPDY----------SASTAYNDIALLELETAAKPELK 239

  Fly   148 ---------YNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY-------GSVGDNIL 196
                     .......|.|:|.|.........|..|.|:.:.|.||..:|       |.:|..:.
  Fly   240 PTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMC 304

  Fly   197 CVRTPDGKSTCGGDSGGPLVTHDGT--KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGI 259
            .......:.||.|||||||:..||.  .:||:|:.|.  ||.||.|:.:.||:..:|||.   ||
  Fly   305 AGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQ--GCASGPPSVYTRVSSFVDWIE---GI 364

  Fly   260 AY 261
            .:
  Fly   365 VW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/252 (27%)
Tryp_SPc 40..256 CDD:238113 69/255 (27%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 69/258 (27%)
Tryp_SPc 132..361 CDD:214473 67/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436971
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.