DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG6041

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:315 Identity:80/315 - (25%)
Similarity:116/315 - (36%) Gaps:118/315 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAV---ASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGL--------GF 59
            ||||:|:   |.|||.::......|:.|        :|..||.|...:..|.|.:        .:
  Fly     6 AILAIALFLGALASGESLSSETAGKIEP--------KIVGGYDASIEQVSYQVSIRLTANDKKSY 62

  Fly    60 SGGWWCGGSIIAHDWVLTAEHC--IGD------ADSVTVYFGATWRTNAQ-----------FTHW 105
            ..|..|||.:|:...|.||.||  |.|      |....:..|:|:.|::.           .||.
  Fly    63 GSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHE 127

  Fly   106 VGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEW-W----------------- 152
            ..|.:.:.:   ||||:.|                     |.|..| |                 
  Fly   128 NYNPDALTN---DIALMFI---------------------NGYIPWNWPTVTALALNSQLVATNT 168

  Fly   153 -AVACGWG-----GTYDGS-------PLPDYLQCVDLQIIHNS-----ECSGYYGSVGDNILCVR 199
             .:..|||     ||:..:       |:..|..|   :|.:||     .|:||...         
  Fly   169 DCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTC---RISYNSIPVSQVCAGYLSG--------- 221

  Fly   200 TPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQS-GAPAGFQRVTYHLDWI 253
               |...|.||||||:..:.  .|.|:.::|  |||.: |.|..:..|:|:.|||
  Fly   222 ---GVDACQGDSGGPMSCNG--MLAGIVSYG--AGCAAPGYPGVYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/277 (24%)
Tryp_SPc 40..256 CDD:238113 69/278 (25%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 67/277 (24%)
Tryp_SPc 35..272 CDD:238113 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.