DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss3

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:280 Identity:83/280 - (29%)
Similarity:121/280 - (43%) Gaps:43/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTK-DMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGS 68
            :..|..:|....|.|...:.|.|.:....: ....||..|..:...:.|:.|.|.|.|...||||
  Rat   181 VTALHHSVYMREGCTSGHVVTLKCSACGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYHLCGGS 245

  Fly    69 IIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQF---------THWVGNGNFIKHS-------SA 117
            :|...|::||.||:.|     :|...:|......         :|.|  ...|.||       ..
  Rat   246 VITPLWIVTAAHCVYD-----LYHPKSWTVQVGLVSLMDSPVPSHLV--EKIIYHSKYKPKRLGN 303

  Fly   118 DIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDG----SPLPDYLQCVDLQ 177
            ||||:::.. :.|...:..:.||:..:.:.|....|  ..|||.|.||    ||:   |....:.
  Rat   304 DIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCW--TSGWGATEDGAGDASPV---LNHAAVP 363

  Fly   178 IIHNSECSG---YYGSVGDNILCV-RTPDGKSTCGGDSGGPLVTHDGT--KLVGVTNFGSVAGC- 235
            :|.|..|:.   |.|.:..::||. ....|..:|.||||||||..:..  ||||.|:||  .|| 
  Rat   364 LISNKICNHRDVYGGIISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFG--IGCA 426

  Fly   236 QSGAPAGFQRVTYHLDWIRD 255
            :...|..:.|:|..||||.:
  Rat   427 EVNKPGVYTRITSFLDWIHE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/241 (31%)
Tryp_SPc 40..256 CDD:238113 76/244 (31%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 6/29 (21%)
Tryp_SPc 216..444 CDD:214473 75/241 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.