DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss30

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:267 Identity:77/267 - (28%)
Similarity:116/267 - (43%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFS-GGWWCGGSIIAHDWVLTA 78
            |.|..:|.:..      |::| .|:|..|..|.||:.|:.|.|..: .|..||||:|...|||||
Mouse    56 ARGDILPSVCG------HSRD-AGKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTA 113

  Fly    79 EHCIGDADSVTVYF----GATWRTNAQFTHWVGNGNFIKH--------SSADIALIRIPHVDFWH 131
            .||...:.:.:.|.    |.|.......:..|...|...|        ||.||||:::.......
Mouse   114 AHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPS 178

  Fly   132 MVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNI- 195
            ....|.||:...........|..  |||.|.: ..:...||.:.:.::.:.:|...|.:.|.:: 
Mouse   179 QFTPVCLPAAQTPLTPGTVCWVT--GWGATQE-RDMASVLQELAVPLLDSEDCEKMYHTQGSSLS 240

  Fly   196 ---------LCVRTPDG-KSTCGGDSGGPLV--THDGTKLVGVTNFGSVAGC-QSGAPAGFQRVT 247
                     ||....:| |.:|.||||||||  .:.....||:|::|  .|| :...|..:.||.
Mouse   241 GERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWG--IGCARPYRPGVYTRVP 303

  Fly   248 YHLDWIR 254
            .::|||:
Mouse   304 TYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/240 (29%)
Tryp_SPc 40..256 CDD:238113 71/242 (29%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.