DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss13

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:249 Identity:79/249 - (31%)
Similarity:108/249 - (43%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVT---------VY 91
            |.|||..|....|.|.|:.|.|.|.....|||::|...|||||.||.    .||         ||
  Rat   294 MTGRIVGGALTSESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCF----FVTREKILEGWKVY 354

  Fly    92 FGATWRTN-------AQFTHWVGNGNFI-KHSSADIALIRI--PHVDFWHMVNKVELPSYNDRYN 146
            .|.   :|       |..:..:.|||:. :....||||:|:  |.....| ::...||.:...:.
  Rat   355 AGT---SNLHQLPEAASISQIIINGNYTDEQDDYDIALVRLSKPLTLSAH-IHPACLPLHGQTFG 415

  Fly   147 DYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTP---------D 202
            .....|....|.....|....| :|:.|.:.:|...:|:.|.  |.|:.|   ||         .
  Rat   416 LNETCWITGFGKTKETDEKTSP-FLREVQVNLIDFKKCNDYL--VYDSYL---TPRMMCAGDLRG 474

  Fly   203 GKSTCGGDSGGPLVTHDGTK--LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            |:.:|.||||||||.....:  |.|||::|:  || |...|..:.:||..|.||
  Rat   475 GRDSCQGDSGGPLVCEQNNRWYLAGVTSWGT--GCGQKNKPGVYTKVTEVLPWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/244 (31%)
Tryp_SPc 40..256 CDD:238113 76/245 (31%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133
SRCR 216..288 CDD:278931
Tryp_SPc 297..526 CDD:214473 75/244 (31%)
Tryp_SPc 298..526 CDD:238113 74/243 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.