DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Klk1c10

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:255 Identity:74/255 - (29%)
Similarity:108/255 - (42%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTN-- 99
            |.||..||..|:...|:.|.:  ...:.|||.:|...||:||.||..:     .|.....|.|  
  Rat    22 QSRIVGGYKCEKNSQPWQVAI--INEYLCGGVLIDPSWVITAAHCYSN-----YYHVLLGRNNLF 79

  Fly   100 -----AQFTHWVGNGNFIKHS----------------------SADIALIRIPH-VDFWHMVNKV 136
                 ||:       .|:..|                      |.|:.|:.:.. .|....|..:
  Rat    80 EDEPFAQY-------RFVNQSFPHPDYKPFLMRNHTRQRGDDYSNDLMLLHLSEPADITDGVKVI 137

  Fly   137 ELPSYNDRYNDYNEWWAVACGWGGTYDGSP----LPDYLQCVDLQIIHNSEC-SGYYGSVGDNIL 196
            :||:...:...    ..:|.|||.|   .|    |||.||||::.::.|.:| ..|...|.|.:|
  Rat   138 DLPTEEPKVGS----TCLASGWGST---KPLNWELPDDLQCVNIHLLSNEKCIEAYEQKVTDLML 195

  Fly   197 CVRTPDG-KSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255
            |....|| |.||.|||||||:. ||. |.|:|::|:|...:...|..:.::.....||::
  Rat   196 CAGEMDGRKDTCKGDSGGPLIC-DGV-LQGITSWGNVPCAEPYNPGVYTKLIKFTSWIKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/249 (29%)
Tryp_SPc 40..256 CDD:238113 72/252 (29%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 71/249 (29%)
Tryp_SPc 25..254 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.