DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Klk11

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:291 Identity:79/291 - (27%)
Similarity:111/291 - (38%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGS 68
            ||| |||......|.|                   ||..||.......|:.|.|.......||.:
  Rat    35 FIA-LALVTGHVGGET-------------------RIIKGYECRPHSQPWQVALFQKTRLLCGAT 79

  Fly    69 IIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWV---GNGNFIKHSSAD---IALIRIPHV 127
            :||..|:|||.||                   :..|:|   |..|..|....:   :|....||.
  Rat    80 LIAPKWLLTAAHC-------------------RKPHYVILLGEHNLEKTDGCEQRRMATESFPHP 125

  Fly   128 DFWH-----------MVNKVELPSYNDRYNDYNEWWAV--------------AC---GWGGTYDG 164
            .|.:           |:.|:..|::..|        ||              :|   |||.|  .
  Rat   126 GFNNSLPNKDHRNDIMLVKMSSPAFITR--------AVRPLTLSSLCVTAGTSCLISGWGTT--S 180

  Fly   165 SP---LPDYLQCVDLQIIHNSECS-GYYGSVGDNILCVRT-PDGKSTCGGDSGGPLVTHDGTKLV 224
            ||   ||..|:|.::.||.:.||. .|.|::.|.:||... .:||.:|.||||||||.:.  .|.
  Rat   181 SPQLRLPHSLRCANVSIIGHKECERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNG--SLQ 243

  Fly   225 GVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255
            |:.::|......:..|..:.:|..:.|||.:
  Rat   244 GIISWGQDPCAVTRKPGVYTKVCKYFDWIHE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/252 (27%)
Tryp_SPc 40..256 CDD:238113 70/255 (27%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 69/252 (27%)
Tryp_SPc 51..275 CDD:238113 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.