DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Mcpt2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:278 Identity:77/278 - (27%)
Similarity:110/278 - (39%) Gaps:64/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTV--------GL 57
            |:|.:.::||.:.|.:||.                   .|..|..:.....||..        ||
  Rat     1 MQALLFLMALLLPSGAGAE-------------------EIIGGVESIPHSRPYMAHLDIVTEKGL 46

  Fly    58 GFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGA-----------TWRTNAQFTHWVGNGNF 111
            ...    |||.:|:..:||||.||.|  ..:||..||           ..:...|..|...|...
  Rat    47 RVI----CGGFLISRQFVLTAAHCKG--REITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVP 105

  Fly   112 IKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVD 175
            ..|   ||.|::: ..|:....||.|.|||.:|..:.....|  |.|||.|....|....|:.|:
  Rat   106 NLH---DIMLLKLEKKVELTPAVNVVPLPSPSDFIHPGAMCW--AAGWGKTGVRDPTSYTLREVE 165

  Fly   176 LQIIHNSECSGYYGSVGDNILCVRTPDG-KSTCGGDSGGPL----VTHDGTKLVGVTNFGSVAGC 235
            |:|:....|..|........:||.:|.. ::...|||||||    |.|      |:.::|..   
  Rat   166 LRIMDEKACVDYRYYEYKFQVCVGSPTTLRAAFMGDSGGPLLCAGVAH------GIVSYGHP--- 221

  Fly   236 QSGAPAGFQRVTYHLDWI 253
            .:..||.|.||:.::.||
  Rat   222 DAKPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/238 (29%)
Tryp_SPc 40..256 CDD:238113 70/239 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 68/238 (29%)
Tryp_SPc 21..242 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.