DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Hpn

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:249 Identity:74/249 - (29%)
Similarity:111/249 - (44%) Gaps:44/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSV----TVYFGATWRTN 99
            ||..|..:..|:.|:.|.|.:.|...||||:::.||||||.||..:.:.|    .|:.||..||:
  Rat   203 RIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVARTS 267

  Fly   100 AQFTHW-----VGNGNF-------IKHSSADIALIR----IPHVDFWHMVNKVELPSYNDRYNDY 148
            ......     :.:|.:       |..:|.||||:.    :|..::   :..|.||:......| 
  Rat   268 PHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEY---IQPVCLPAAGQALVD- 328

  Fly   149 NEWWAVAC---GWGGTYDGSPLPDYLQCVDLQIIHNSECSG--YYGS-VGDNILCVRTPDGK-ST 206
                ...|   |||.|.........||...:.||.|..|:.  :||: :...:.|...|:|. ..
  Rat   329 ----GKVCTVTGWGNTQFYGQQAVVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGIDA 389

  Fly   207 CGGDSGGPLVTHD---GT---KLVGVTNFGSVAGCQ-SGAPAGFQRVTYHLDWI 253
            |.||||||.|..|   ||   :|.|:.::|:  ||. :..|..:.:|....:||
  Rat   390 CQGDSGGPFVCEDRISGTSRWRLCGIVSWGT--GCALARKPGVYTKVIDFREWI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/247 (29%)
Tryp_SPc 40..256 CDD:238113 73/248 (29%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275
Tryp_SPc 204..441 CDD:238113 71/246 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.