DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss7

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099352.2 Gene:Tmprss7 / 288118 RGDID:1304655 Length:829 Species:Rattus norvegicus


Alignment Length:246 Identity:71/246 - (28%)
Similarity:111/246 - (45%) Gaps:40/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC-----IGDADSVTVYFGATWRT 98
            |:..|..::||..|:.|.|.|.|...||.|:|:.:|:|:|.||     :.|....|.:.|...:.
  Rat   591 RVVGGSDSQEGTWPWQVSLHFVGSAHCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQG 655

  Fly    99 NAQF--------THWVGNGNFIKHSSADIALIRIPHVDFW-----HMVNKVELPSYNDRYNDYNE 150
            ||:|        .|...|.....:   ||||:::...  |     .::..:.:|....|.....:
  Rat   656 NAKFVSPVRRIVVHEYYNSQTFDY---DIALLQLSIA--WPETLRQLIQPICIPPVGQRVRSGEK 715

  Fly   151 WWAVACGWGGTYD----GSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKS-TCGGD 210
            .|..  |||..::    |||:   ||..::::|..:.|...||.:...:||.....||| .|.||
  Rat   716 CWVT--GWGRRHEADSKGSPI---LQQAEVELIDQTVCVSTYGIITSRMLCAGVMSGKSDACKGD 775

  Fly   211 SGGPLVTH---DGT-KLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDH 256
            |||||...   ||. .|.|:.::|  .|| :...|..:.||:..:.||..:
  Rat   776 SGGPLSCRRKSDGKWILTGIVSWG--YGCGRPNFPGVYTRVSNFVPWIHKY 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/241 (29%)
Tryp_SPc 40..256 CDD:238113 70/243 (29%)
Tmprss7NP_001099352.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
SEA 94..190 CDD:279699
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060
Tryp_SPc 591..821 CDD:214473 69/241 (29%)
Tryp_SPc 592..823 CDD:238113 70/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.