DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss34

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:277 Identity:85/277 - (30%)
Similarity:120/277 - (43%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSG---GWW---CGGSIIAHDWV 75
            |:|||      |||...:::.| |..|.|....:.|:.|.|.|..   ..|   ||||:|...||
  Rat    17 GSTMP------LTPDSGQELVG-IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWV 74

  Fly    76 LTAEHCIG----DADSVTVYFG-ATWRTNAQFTHWVGNGNFIKH----------SSADIALIRIP 125
            |||.||:.    :|....|..| .....|.|.   :.....|:|          ..|||||:::.
  Rat    75 LTAAHCVELKEMEASCFRVQVGQLRLYENDQL---MKVAKIIRHPKFSEKLSAPGGADIALLKLD 136

  Fly   126 H-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPD--YLQCVDLQIIHNSECSGY 187
            . |.....|:.|.||:.:.|.:....||  ..|||......|||.  :|:.|.:.|:.||:|...
  Rat   137 STVVLSERVHPVSLPAASQRISSKKTWW--VAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQK 199

  Fly   188 YGS----------VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK--LVGVTNFGSVAGC-QSGA 239
            |.:          :.|::||... :|:.:|..|||||||......  .|||.::|  .|| ....
  Rat   200 YRTYSSLDRTTKIIKDDMLCAGM-EGRDSCQADSGGPLVCRWNCSWVQVGVVSWG--IGCGLPDF 261

  Fly   240 PAGFQRVTYHLDWIRDH 256
            |..:.||..:|.||..:
  Rat   262 PGVYTRVMSYLSWIHGY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/250 (30%)
Tryp_SPc 40..256 CDD:238113 77/252 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 76/250 (30%)
Tryp_SPc 33..275 CDD:214473 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.