DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG33462

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:246 Identity:55/246 - (22%)
Similarity:94/246 - (38%) Gaps:54/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFG----------------- 93
            |:..:.|:...|....|:.|.|::|.|.:||||.||:.|...:||..|                 
  Fly    42 AKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQE 106

  Fly    94 --ATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYN---DYNEWW 152
              ..:..:..|.|...|.|   ..:.||.::|: ..|::.:.:..:.:.:.| |:.   |...|:
  Fly   107 PFQEYNVDMGFRHRYYNAN---DQTNDIGMLRLGRRVEYLNHIRPICIFASN-RFQEPIDQLTWF 167

  Fly   153 AVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYG--------SVGDNILCVRTPDGKSTCGG 209
            .... |..| ..:.....|:.:::.......||..||        ..|:.:        ...|..
  Fly   168 TTTV-WRET-AANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTL--------SQLCST 222

  Fly   210 DSGGPLVT---HDGT-KLVGVTNFGSVAG-CQ-SGAPAGFQRVTYHLDWIR 254
            |||.|.:.   |:|: :.|.:.....|.| || ||.   ...:..:.|||:
  Fly   223 DSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGI---LMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/243 (22%)
Tryp_SPc 40..256 CDD:238113 55/246 (22%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 54/240 (23%)
Tryp_SPc 48..269 CDD:214473 52/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.