DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tpsg1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:274 Identity:85/274 - (31%)
Similarity:124/274 - (45%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAH 72
            ||.:|:|.||...|:::          :...||..|:.|..|..|:...|.......||||:::.
Mouse    65 LANSVSSGSGCGHPQVS----------NSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSP 119

  Fly    73 DWVLTAEHCI-GDADS---------VTVYFGATWRTNAQFTHWVGN----GNFIKHSSADIALIR 123
            :|||||.||. |..:|         :||.....:.|..:...:.|:    |     ||.||||::
Mouse   120 EWVLTAAHCFSGSVNSSDYQVHLGELTVTLSPHFSTVKRIIMYTGSPGPPG-----SSGDIALVQ 179

  Fly   124 IPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL-PDY-LQCVDLQIIHNSECS 185
            :.. |.....|..|.||..:..:....:.|..  |||.|.:|.|| |.| ||...:.::....||
Mouse   180 LSSPVALSSQVQPVCLPEASADFYPGMQCWVT--GWGYTGEGEPLKPPYNLQEAKVSVVDVKTCS 242

  Fly   186 GYYGS-----VGDNILCVRTPDGKSTCGGDSGGPLVTH-DGT-KLVGVTNFGSVAGC-QSGAPAG 242
            ..|.|     :..::||.|.|.  ..|..|||||||.. .|| :..||.::|.  || :...|..
Mouse   243 QAYNSPNGSLIQPDMLCARGPG--DACQDDSGGPLVCQVAGTWQQAGVVSWGE--GCGRPDRPGV 303

  Fly   243 FQRVTYHLDWIRDH 256
            :.|||.:::||..|
Mouse   304 YARVTAYVNWIHHH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/238 (32%)
Tryp_SPc 40..256 CDD:238113 76/240 (32%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.