DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:287 Identity:90/287 - (31%)
Similarity:129/287 - (44%) Gaps:78/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKA--FIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW 63
            |:|  |:|::..|||               .||...|   :|..||..:|...||.|.|. ||..
  Rat     1 MRALLFLALVGAAVA---------------FPVDDDD---KIVGGYTCQENSVPYQVSLN-SGYH 46

  Fly    64 WCGGSIIAHDWVLTAEHC--------IGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHS----- 115
            :||||:|...||::|.||        :|: .::.|..|     |.||   |.....|||.     
  Rat    47 FCGGSLINDQWVVSAAHCYKSRIQVRLGE-HNINVLEG-----NEQF---VNAAKIIKHPNFDRK 102

  Fly   116 --SADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVAC----------GWGGTY-DGSP 166
              :.||.||::.. |.....|..|.|||              :|          |||.|. .|..
  Rat   103 TLNNDIMLIKLSSPVKLNARVATVALPS--------------SCAPAGTQCLISGWGNTLSSGVN 153

  Fly   167 LPDYLQCVDLQIIHNSEC-SGYYGSVGDNILCVR-TPDGKSTCGGDSGGPLVTHDGTKLVGVTNF 229
            .||.|||:|..::..::| :.|.|.:.||::||. ...||.:|.||||||:|.:.  :|.|:.::
  Rat   154 EPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNG--ELQGIVSW 216

  Fly   230 GSVAGCQ-SGAPAGFQRVTYHLDWIRD 255
            |  .||. ...|..:.:|..::|||:|
  Rat   217 G--YGCALPDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 77/243 (32%)
Tryp_SPc 40..256 CDD:238113 80/246 (33%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 77/243 (32%)
Tryp_SPc 24..242 CDD:238113 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.