DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30323

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:198 Identity:39/198 - (19%)
Similarity:68/198 - (34%) Gaps:58/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSS------------ 116
            :|.||:::..||:|:..|:......|....:. |.|.:..  |.....:|..|            
  Fly    53 FCAGSLLSAWWVVTSGCCVSTRPESTPNQPSN-RKNLRVV--VFTPKRLKKPSPKNIYHVQKIVL 114

  Fly   117 --------ADIALIRIPH----VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPD 169
                    .::||:::..    ..|..|:.:.||.|         .|...:.|||..|..|.:..
  Fly   115 DESAISGCTELALLKLDRGVTGQRFAMMLPEKELNS---------TWLCNSLGWGRIYYVSYVYI 170

  Fly   170 YLQCVDLQIIHNSECS----GYYGSVGDNI-----------------LCVRTPDGK-STCGGDSG 212
            ...|....:::::..:    |.|.|....|                 ||:.:..|: :.|..|.|
  Fly   171 SAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNMCQQDLG 235

  Fly   213 GPL 215
            .||
  Fly   236 SPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 39/198 (20%)
Tryp_SPc 40..256 CDD:238113 39/198 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 39/198 (20%)
Tryp_SPc 45..272 CDD:214473 39/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.