DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30286

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:244 Identity:64/244 - (26%)
Similarity:106/244 - (43%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFG--------------- 93
            :.|...::|:...|..||...|||:::.|.::|||.|||.:.:::||..|               
  Fly    39 HQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDC 103

  Fly    94 ----ATWRTNAQFTHWVGNGNFIKHSSA-DIALIRIP-------HVDFWHMVNKVELPSYNDRYN 146
                ..:..:..|.|    |.:.:.:.. ||.|:|:.       |:....::....|....:|.:
  Fly   104 LPPSEDFEIDVAFRH----GGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLH 164

  Fly   147 DYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECS-GYYGSVGDNILCVRTPDGKSTCGGD 210
            .     .||.|||.: ........|:.:.:..::...|| .|:.....:.:||....|.| |.||
  Fly   165 R-----LVATGWGRS-PSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESGVS-CSGD 222

  Fly   211 SGGPL---VTHDGTKL---VGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            ||||:   :..||..|   ||:.::|: |.|.|  |:.|..|..|:|||
  Fly   223 SGGPMGQAIRLDGRVLFVQVGIVSYGN-AECLS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 62/242 (26%)
Tryp_SPc 40..256 CDD:238113 64/244 (26%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 64/244 (26%)
Tryp_SPc 39..268 CDD:214473 62/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.