DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30187

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:257 Identity:72/257 - (28%)
Similarity:101/257 - (39%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWW-----------CGGSIIAHDWVLTAEHCIGDADSVTVYF 92
            :||.|:.|           .|....|           |||::|...:||||.|||.|.|..:|..
  Fly    35 KITGGHNA-----------AFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSL 88

  Fly    93 GA-------------------TWRTNAQFTHWVGNGNFIKHSSADI--ALIRIPHVDFWHMVNKV 136
            ||                   ::...|.:.:.:|   .:|.||..|  ||||    ....::|| 
  Fly    89 GAYNKSDPADRKDVITAVVHSSFDVRASYENDIG---LLKLSSDVIFNALIR----PICIVLNK- 145

  Fly   137 ELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC---SGYYGSVGDNILCV 198
            .:.::......:.     |.|| ||..|:...|.||.:.|..:...||   ...|.|  :..:|.
  Fly   146 SMANHMRNMRTFK-----AFGW-GTLRGNKTSDILQTIILNHLDREECYMELSVYPS--EKQICA 202

  Fly   199 RTPDGKSTCGGDSGGPLVTHDGTKLVGVTN----FG--SVAGCQSGAPAGFQRVTYHLDWIR 254
            ..|.| .|||||||||| |:| ..:.|:.|    ||  ||..........:..:....|||:
  Fly   203 GVPSG-DTCGGDSGGPL-TND-VFIQGIGNREVQFGIISVGKTSCDGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/254 (28%)
Tryp_SPc 40..256 CDD:238113 72/256 (28%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 70/254 (28%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.