DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30091

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:119/293 - (40%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAFIAILALAVASASGATMPRLATE------KLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFS 60
            :|::.:.|..:.:..|:.  ||..|      :|.|        :|..|..|.|.|.|:...:..:
  Fly     3 RAWVVLFAWMLTAGRGSA--RLLDEDCGVPMQLIP--------KIVGGVDAGELKNPWMALIKTN 57

  Fly    61 GGWWCGGSIIAHDWVLTAEHCI-GDADSVTVYFGATWRTNAQFTHWVGNGN-----------FIK 113
            ..:.||||:|.:.:||||.||: .|.:.:..|...|...........|..|           :|.
  Fly    58 DEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIH 122

  Fly   114 HSSA------DIALIRI-------PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS 165
            .|.|      ||||:|:       |.:....::...:|....|...::     .|.|||.|.:|.
  Fly   123 DSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEF-----TAIGWGVTGNGK 182

  Fly   166 PLPDYLQCVDLQIIHNSECSGYYGSVGD-NILCVRTPDGKSTCGGDSGGPLVTH---DGTK---L 223
             :.:.||.|.:..|....|...:....| .:.|..|..|:.||..||||||..|   ||.|   .
  Fly   183 -MSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQ 246

  Fly   224 VGVTNFGSVAGCQSGAPAGFQRVT---YHLDWI 253
            :|:.:.|: ..|:     ||...|   .|:|:|
  Fly   247 LGIVSTGT-EDCR-----GFGMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/248 (27%)
Tryp_SPc 40..256 CDD:238113 69/249 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 68/248 (27%)
Tryp_SPc 37..276 CDD:238113 69/249 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.