DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30090

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:121/283 - (42%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAILALAVASASGATMPRLATEKLTP---VHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWW 64
            |..||.|||:    |........|.|.|   :....:..:|..|..|.....|:...:..|....
  Fly     4 AIAAITALAI----GVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLI 64

  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFG-----ATWRTNAQ--------------FTHWVGNGN 110
            |||::|...:||||.||:.:..:|.|..|     ||...|::              |.|  |..:
  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRH--GKFS 127

  Fly   111 FIKHSSADIALIRI-PHVDFWHMVNK--VELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQ 172
            .||:.: ||||:|: ..|.|...::.  :.|.:......|..||: ||.|||.|.. ......||
  Fly   128 EIKNLN-DIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWF-VATGWGETRT-HRTRGVLQ 189

  Fly   173 CVDLQIIHNSECSGYYGS-VGDNILCVRTPDGKSTCGGDSGGPL---VTH-DGTKLV--GVTNFG 230
            ...||..::|:|....|. |..|.:|.... |..||.|||||||   |.| |..:.|  ||.::|
  Fly   190 ITQLQRYNSSQCMQALGRLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYG 253

  Fly   231 SVAGCQSGAPAGFQRVTYHLDWI 253
            | ..| ||... :..|..:.|||
  Fly   254 S-REC-SGIGV-YTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 76/242 (31%)
Tryp_SPc 40..256 CDD:238113 78/243 (32%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 76/242 (31%)
Tryp_SPc 40..276 CDD:238113 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.