DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30088

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:264 Identity:70/264 - (26%)
Similarity:103/264 - (39%) Gaps:82/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC--------IGD----------- 84
            ||..|..|....||:...|.:|....|||:||:..::|||.||        :|:           
  Fly    44 RIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQG 108

  Fly    85 ------ADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYND 143
                  |:...:.....::   :|..::.|         ||||:::               |.|.
  Fly   109 GSCSPPAEEFDIVLATKYK---RFDRFLAN---------DIALLKL---------------SRNI 146

  Fly   144 RYN----------------DYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYG-SV 191
            |:|                :.:|:.|.  |||.| :.:...:.||...|....|..|..... .:
  Fly   147 RFNVHIQPICLILNPAAAPNVHEFQAF--GWGQT-ETNHSANVLQTTVLTRYDNRHCRSVLSMPI 208

  Fly   192 GDNILCVRTPDGKSTCGGDSGGPLVT---HDGT---KLVGVTNFGSVAGCQSGAPAGFQRVTYHL 250
            ..|.|||.. .|..||.|||||||||   :||.   ..:|:.:||. ..|||  |..:..|..::
  Fly   209 TINQLCVGF-QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGD-DKCQS--PGVYTYVPNYI 269

  Fly   251 DWIR 254
            .|||
  Fly   270 RWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/261 (26%)
Tryp_SPc 40..256 CDD:238113 69/263 (26%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 67/261 (26%)
Tryp_SPc 45..273 CDD:238113 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.