DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30087

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:253 Identity:69/253 - (27%)
Similarity:105/253 - (41%) Gaps:59/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI--------------GDADSVT 89
            |:.||..|....||:.|.:..:....|||||:...::|||.||:              .|.|.. 
  Fly    41 RVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPDCQ- 104

  Fly    90 VYFGATWRTNAQ-------FTHWVGN-GNFIKHSSADIALIRI-------PHVD-FWHMVNKVEL 138
               |:.....::       .||...| .|.:.    ||||:::       .|:. ...::|....
  Fly   105 ---GSNCSPRSEEYGIMKAITHRFYNAANHVN----DIALLKLNRSINFNVHIQPICILLNPASA 162

  Fly   139 PSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECS-GYYGSVGDNILCVRTPD 202
            ||. ..|..:        |||.|.... .|..||..:|:....:.|| .::..:..|.:|....:
  Fly   163 PSV-ATYQTF--------GWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHEE 217

  Fly   203 GKSTCGGDSGGPLVTH---DGTK---LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
             :.||.|||||||||.   ||.|   .:|:.::|. ..|||  |..:..|..:::|||
  Fly   218 -RDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGP-TDCQS--PGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/250 (26%)
Tryp_SPc 40..256 CDD:238113 68/252 (27%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 66/250 (26%)
Tryp_SPc 42..272 CDD:238113 68/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435743
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.