DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Klk1b3

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:272 Identity:81/272 - (29%)
Similarity:120/272 - (44%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIA 71
            ||.||::.......|        ||     |.|:..||..|....|:.|.:.:.|.:.|||.:|.
  Rat     9 ILFLALSLGRNDAAP--------PV-----QSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLID 60

  Fly    72 HDWVLTAEHCIGDADSVTVYFG----------ATWRTNAQ-FTHWVGNGNFI-KHS-------SA 117
            ..||:||.||.  .|:..|:.|          |..|..:| |.|...|.:.| .|:       |.
  Rat    61 PSWVITAAHCA--TDNYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSN 123

  Fly   118 DIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGG-TYDGSPLPDYLQCVDLQIIH 180
            |:.|:.:.. .|....|..::||....:...    ..:|.|||. |.||..|.|.||||::.::.
  Rat   124 DLMLLHLSQPADITDGVKVIDLPIEEPKVGS----TCLASGWGSITPDGLELSDDLQCVNIDLLS 184

  Fly   181 NSEC-SGYYGSVGDNILCVRTPD-GKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGF 243
            |.:| ..:...|.|.:||....| ||.||.|||||||:.:.  .|.|:|::|.....:...|..:
  Rat   185 NEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICNG--VLQGITSWGFNPCGEPKKPGIY 247

  Fly   244 QRVTYHLDWIRD 255
            .::.....||::
  Rat   248 TKLIKFTPWIKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/236 (30%)
Tryp_SPc 40..256 CDD:238113 72/239 (30%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 71/236 (30%)
Tryp_SPc 29..260 CDD:238113 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.