DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Ctrb1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:274 Identity:84/274 - (30%)
Similarity:125/274 - (45%) Gaps:47/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW-WCGGS 68
            ::..|| |.:..|..:|     .:.||.|.  ..||.||..|..|..|:.|.|....|: :||||
  Rat     7 VSCFAL-VGATFGCGVP-----TIQPVLTG--LSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGS 63

  Fly    69 IIAHDWVLTAEHC---------------IGDADSVTVYFGATWRTNAQFTHW-VGNGNFIKHSSA 117
            :|:.|||:||.||               ..|.:::.|...|....|.:|..: |.|         
  Rat    64 LISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRN--------- 119

  Fly   118 DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVAC---GWGGT-YDGSPLPDYLQCVDLQ 177
            ||.|::: ....|...|:.|.||:.:|.:..     ...|   |||.| |:....|:.||...|.
  Rat   120 DITLLKLATPAQFSETVSAVCLPNVDDDFPP-----GTVCATTGWGKTKYNALKTPEKLQQAALP 179

  Fly   178 IIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTH-DGT-KLVGVTNFGSVAGCQSGAP 240
            |:..::|...:||...:::......|.|:|.||||||||.. ||. .|.|:.::|| ..|.:..|
  Rat   180 IVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGS-GVCSTSTP 243

  Fly   241 AGFQRVTYHLDWIR 254
            |.:.|||..:.|::
  Rat   244 AVYSRVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/237 (32%)
Tryp_SPc 40..256 CDD:238113 75/239 (31%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 75/237 (32%)
Tryp_SPc 34..259 CDD:238113 75/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.