DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and TPSD1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:242 Identity:68/242 - (28%)
Similarity:102/242 - (42%) Gaps:46/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWW---CG 66
            :.:|||.|.::.....|       .|.......| |..|..|...|.|:.|.|...|.:|   ||
Human    11 LLLLALPVLASPAYVAP-------APGQALQQTG-IVGGQEAPRSKWPWQVSLRVRGPYWMHFCG 67

  Fly    67 GSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHW-------------VGNGNFIKHSSAD 118
            ||:|...|||||.||: :.|...:   |..|...:..|.             |....:|..:.||
Human    68 GSLIHPQWVLTAAHCV-EPDIKDL---AALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGAD 128

  Fly   119 IALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS---PLPDYLQCVDLQII 179
            |||:.:.. |:....::.|.||..::.:......|..  |||.. |.:   |.|..|:.|::.::
Human   129 IALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVT--GWGDV-DNNVHLPPPYPLKEVEVPVV 190

  Fly   180 HNSECSGYYGS----------VGDNILCVRTPDGKSTCGGDSGGPLV 216
            .|..|:..|.:          |.|::||..: :...:|.||||||||
Human   191 ENHLCNAEYHTGLHTGHSFQIVRDDMLCAGS-ENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/208 (29%)
Tryp_SPc 40..256 CDD:238113 61/207 (29%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 61/207 (29%)
Tryp_SPc 38..240 CDD:214473 61/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.