DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss11d

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:240 Identity:81/240 - (33%)
Similarity:116/240 - (48%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSV---TVYFGATW---- 96
            ||..|..||.|..|:.|.|..:....|||::|::.|||||.||.....:.   |..||.:.    
Mouse   185 RIIGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWVLTAAHCFKSYPNPQYWTATFGVSTMSPR 249

  Fly    97 ---RTNAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACG 157
               |..|...|   :|........|||::::.. |.|...:::|.||:...  |......|...|
Mouse   250 LRVRVRAILAH---DGYSSVTRDNDIAVVQLDRSVAFSRNIHRVCLPAATQ--NIIPGSVAYVTG 309

  Fly   158 WGG-TYDGSPLPDYLQCVDLQIIHNSEC---SGYYGSVGDNILCVRTPDGK-STCGGDSGGPLVT 217
            ||. ||.|:.:.: |:..:::||.:.||   :||.|||...:||.....|. ..|.||||||||.
Mouse   310 WGSLTYGGNAVTN-LRQGEVRIISSEECNTPAGYSGSVLPGMLCAGMRSGAVDACQGDSGGPLVQ 373

  Fly   218 HDGTKL---VGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGI 259
            .|..:|   ||:.::|...|..: .|..:.|||.:.:|||..|||
Mouse   374 EDSRRLWFVVGIVSWGYQCGLPN-KPGVYTRVTAYRNWIRQQTGI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/232 (32%)
Tryp_SPc 40..256 CDD:238113 77/234 (33%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 75/232 (32%)
Tryp_SPc 186..414 CDD:238113 77/234 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.