DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and F11

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:267 Identity:83/267 - (31%)
Similarity:122/267 - (45%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSG---GWWCGGSIIAHDWVLT 77
            ||.|: ||.  |:....|..::.||..|..:..|:.|:.|.|..:.   ...||||||.:.|:||
Human   368 SGYTL-RLC--KMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILT 429

  Fly    78 AEHCIGDADS---VTVYFGATWRTN-AQFTHWVGNGNFIKH-------SSADIALIRI-PHVDFW 130
            |.||....:|   :.||.|...::. .:.|.:.|....|.|       |..||||::: ..|::.
Human   430 AAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYT 494

  Fly   131 HMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY--GSVGD 193
            .....:.|||..||...|.:.|..  |||.......:.:.||...:.::.|.||...|  ..:..
Human   495 DSQRPICLPSKGDRNVIYTDCWVT--GWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITH 557

  Fly   194 NILCVRTPD-GKSTCGGDSGGPL------VTHDGTKLVGVTNFGSVAGC-QSGAPAGFQRVTYHL 250
            .::|....: ||..|.|||||||      |.|    |||:|::|.  || |...|..:..|..::
Human   558 KMICAGYREGGKDACKGDSGGPLSCKHNEVWH----LVGITSWGE--GCAQRERPGVYTNVVEYV 616

  Fly   251 DWIRDHT 257
            |||.:.|
Human   617 DWILEKT 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/238 (31%)
Tryp_SPc 40..256 CDD:238113 74/240 (31%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519 4/7 (57%)
Tryp_SPc 388..619 CDD:214473 73/238 (31%)
Tryp_SPc 389..619 CDD:238113 72/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.