DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and F10

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:271 Identity:68/271 - (25%)
Similarity:106/271 - (39%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGL------GFSGGWWCGGSIIAHDWVLT 77
            |.|......||         ||..|...::|:.|:...|      ||     |||:|::..::||
Human   223 TQPERGDNNLT---------RIVGGQECKDGECPWQALLINEENEGF-----CGGTILSEFYILT 273

  Fly    78 AEHCIGDADSVTVYFG---ATWRTNAQFTHWV----GNGNFIKHS-SADIALIRI-PHVDFWHMV 133
            |.||:..|....|..|   .......:..|.|    .:..|.|.: ..|||::|: ..:.|...|
Human   274 AAHCLYQAKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNV 338

  Fly   134 NKVELPSYNDRYNDYNEWWA----------VACGWGGTYDGSPLPDYLQCVDLQIIHNSEC---S 185
            ....||..:         ||          :..|:|.|::.......|:.:::..:..:.|   |
Human   339 APACLPERD---------WAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSS 394

  Fly   186 GYYGSVGDNILCVRTPDGKST-----CGGDSGGPLVTH--DGTKLVGVTNFGSVAGC-QSGAPAG 242
            .:.  :..|:.|.    |..|     |.||||||.||.  |...:.|:.::|.  || :.|....
Human   395 SFI--ITQNMFCA----GYDTKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGE--GCARKGKYGI 451

  Fly   243 FQRVTYHLDWI 253
            :.:||..|.||
Human   452 YTKVTAFLKWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 62/249 (25%)
Tryp_SPc 40..256 CDD:238113 63/250 (25%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 63/250 (25%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.