DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and F9

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:263 Identity:66/263 - (25%)
Similarity:104/263 - (39%) Gaps:74/263 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFT 103
            |:..|..|:.|:.|:.|.|......:|||||:...|::||.||:.....:||..|   ..|.:.|
Human   226 RVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAG---EHNIEET 287

  Fly   104 HWVGNGNFIKHSSADIALIR-IPHVDFWHMVNKVELPSYN--------DRYNDYNEWWAVAC--- 156
                     :|:.....:|| |||.::...:||     ||        |.....|.:....|   
Human   288 ---------EHTEQKRNVIRIIPHHNYNAAINK-----YNHDIALLELDEPLVLNSYVTPICIAD 338

  Fly   157 ----------------GWGGTYDGS-----------PLPDYLQCV---DLQIIHNSECSGYYGSV 191
                            |||..:...           ||.|...|:   ...|.:|..|:|::   
Human   339 KEYTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFH--- 400

  Fly   192 GDNILCVRTPDGKSTCGGDSGGPLVTH-DGTK-LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
                     ..|:.:|.||||||.||. :||. |.|:.::|... ...|....:.:|:.:::||:
Human   401 ---------EGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEEC-AMKGKYGIYTKVSRYVNWIK 455

  Fly   255 DHT 257
            :.|
Human   456 EKT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/257 (25%)
Tryp_SPc 40..256 CDD:238113 64/259 (25%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 64/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.