Sequence 1: | NP_648217.1 | Gene: | Jon66Cii / 38953 | FlyBaseID: | FBgn0035887 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000124.1 | Gene: | F9 / 2158 | HGNCID: | 3551 | Length: | 461 | Species: | Homo sapiens |
Alignment Length: | 263 | Identity: | 66/263 - (25%) |
---|---|---|---|
Similarity: | 104/263 - (39%) | Gaps: | 74/263 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFT 103
Fly 104 HWVGNGNFIKHSSADIALIR-IPHVDFWHMVNKVELPSYN--------DRYNDYNEWWAVAC--- 156
Fly 157 ----------------GWGGTYDGS-----------PLPDYLQCV---DLQIIHNSECSGYYGSV 191
Fly 192 GDNILCVRTPDGKSTCGGDSGGPLVTH-DGTK-LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
Fly 255 DHT 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon66Cii | NP_648217.1 | Tryp_SPc | 39..253 | CDD:214473 | 63/257 (25%) |
Tryp_SPc | 40..256 | CDD:238113 | 64/259 (25%) | ||
F9 | NP_000124.1 | GLA | 28..92 | CDD:214503 | |
EGF_CA | 93..129 | CDD:238011 | |||
FXa_inhibition | 134..170 | CDD:317114 | |||
Tryp_SPc | 227..457 | CDD:238113 | 64/259 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |