DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and F2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_000497.1 Gene:F2 / 2147 HGNCID:3535 Length:622 Species:Homo sapiens


Alignment Length:270 Identity:72/270 - (26%)
Similarity:105/270 - (38%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGG---WWCGGSIIAHDWVLTAEHCI--------GDADSVT 89
            :.|||..|..||.|.:|:.|.| |...   ..||.|:|:..|||||.||:        ...:.:.
Human   360 IDGRIVEGSDAEIGMSPWQVML-FRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLL 423

  Fly    90 VYFGATWRTNAQ------------FTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELP-- 139
            |..|...||..:            :.|  ...|:.::...||||:::.. |.|...::.|.||  
Human   424 VRIGKHSRTRYERNIEKISMLEKIYIH--PRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDR 486

  Fly   140 ---------SYNDRYNDYNEWWAVACGWGGTYD------GSPLPDYLQCVDLQIIHNSECSGYYG 189
                     .|..|          ..|||...:      |...|..||.|:|.|:....|.....
Human   487 ETAASLLQAGYKGR----------VTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTR 541

  Fly   190 -SVGDNILCV--RTPDGK--STCGGDSGGPLVT----HDGTKLVGVTNFGSVAGCQSGAPAGFQR 245
             .:.||:.|.  :..:||  ..|.||||||.|.    ::....:|:.::|.  ||......||..
Human   542 IRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGE--GCDRDGKYGFYT 604

  Fly   246 VTYHL-DWIR 254
            ..:.| .||:
Human   605 HVFRLKKWIQ 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/264 (26%)
Tryp_SPc 40..256 CDD:238113 70/266 (26%)
F2NP_000497.1 GLA 25..88 CDD:214503
KR 105..186 CDD:238056
KR 211..293 CDD:214527
Thrombin_light 317..363 CDD:286482 0/2 (0%)
Tryp_SPc 363..613 CDD:214473 69/264 (26%)
Tryp_SPc 364..616 CDD:238113 70/266 (26%)
High affinity receptor-binding region which is also known as the TP508 peptide 551..573 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.