DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss27

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:285 Identity:83/285 - (29%)
Similarity:119/285 - (41%) Gaps:65/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PRLATEKLTPV----------------HTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSI 69
            |.:|...|.|:                |.| |..|:..|..|.||:.|:.|.:..:|..:||||:
Mouse     4 PHIAALLLLPLLLRSGTEGARTLRACGHPK-MFNRMVGGENALEGEWPWQVSIQRNGIHFCGGSL 67

  Fly    70 IAHDWVLTAEHCIGDADSVTVY---FGA----------------TWRTNAQFTHWVGNGNFIKHS 115
            ||..|||||.||..:...:::|   .||                ..::|.|:....        |
Mouse    68 IAPTWVLTAAHCFSNTSDISIYQVLLGALKLQQPGPHALYVPVKQVKSNPQYQGMA--------S 124

  Fly   116 SADIALIRIP-HVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG--GTYDGSPLPDYLQCVDLQ 177
            |||:||:.:. .|.|.:.:..|.||..:..:......|..  |||  ...|..|.|..||.:.:.
Mouse   125 SADVALVELQGPVTFTNYILPVCLPDPSVIFESGMNCWVT--GWGSPSEQDRLPNPRVLQKLAVP 187

  Fly   178 IIHNSECSGYYG----------SVGDNILCVRTPDG-KSTCGGDSGGPLV--THDGTKLVGVTNF 229
            ||...:|:..|.          ::.|::||....:| |..|.||||||||  ........||.::
Mouse   188 IIDTPKCNLLYNKDVESDFQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQSWVQAGVISW 252

  Fly   230 GSVAGC-QSGAPAGFQRVTYHLDWI 253
            |.  || :...|..:.|||.|..||
Mouse   253 GE--GCARRNRPGVYIRVTSHHKWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 74/249 (30%)
Tryp_SPc 40..256 CDD:238113 75/250 (30%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 74/249 (30%)
Tryp_SPc 39..278 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.