DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss11a

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006534903.1 Gene:Tmprss11a / 194597 MGIID:2684853 Length:392 Species:Mus musculus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:109/266 - (40%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VHTKD--------MQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADS 87
            |..||        :..||.:|.||.:|..|:.|.|..|....|||::|.:.||:||.||      
Mouse   144 VQVKDCGKRAIPLIANRIVSGNPAAKGAWPWQVSLQRSNIHQCGGTLIGNMWVVTAAHC------ 202

  Fly    88 VTVYFGATWRTNAQFTHWVGN--------------GNFIKHS-------SADIALIRI-PHVDFW 130
                    :|||:....|..:              ...|.|.       ..||||::. |.|.|.
Mouse   203 --------FRTNSNPRQWTLSFGTTINPPLMKRDVRRIIMHERYRPPARDHDIALVQFSPRVTFS 259

  Fly   131 HMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSG---YYGSVG 192
            ..|.::.||..:..:...:..:..  |:|..|.|....:.|:...:|||.|..|..   |...:.
Mouse   260 DEVRRICLPEPSASFPPNSTVYIT--GFGALYYGGESQNELREARVQIISNDICKKRHVYGNEIK 322

  Fly   193 DNILCVRTPDGK-STCGGDSGGPLVTHDGTK---LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            ..:.|....:|. ..|.||||||||..|...   |:|:.::|...| |...|..:.:|||:..||
Mouse   323 RGMFCAGFLEGNYDACRGDSGGPLVIRDNKDTWYLIGIVSWGDNCG-QKNKPGVYTQVTYYRHWI 386

  Fly   254 RDHTGI 259
            ...||:
Mouse   387 ASKTGL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/242 (28%)
Tryp_SPc 40..256 CDD:238113 69/244 (28%)
Tmprss11aXP_006534903.1 SEA 42..135 CDD:366610
Tryp_SPc 161..389 CDD:238113 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.