DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and try-5

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:230 Identity:53/230 - (23%)
Similarity:81/230 - (35%) Gaps:71/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIIAHDWVLTAEHCI----------GDADSVTVYFGATWRTNAQFTH---------WVG--- 107
            |||::|....||||.||.          |:.:|::   |....:|.:||.         .||   
 Worm    73 CGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMS---GRYCESNQRFTDSEILTRTVVTVGAMC 134

  Fly   108 --------------NGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVAC-- 156
                          ||..:|.|...|......|.:..:.:..:||.|..|.....|    .||  
 Worm   135 TRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGAN----YACLP 195

  Fly   157 ----------------GWGGT----YDGSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCVRT 200
                            |||..    :|.:..| .:|.:.|.....:.|...:| |:..:..|...
 Worm   196 FLPEVNIQSGANVTSFGWGSDPGKGFDNAAFP-MIQVLTLATETLATCEENWGTSIPFDSFCTAE 259

  Fly   201 PDGKSTCGGDSGGPLVTHDGTK----LVGVTNFGS 231
            .:.|:.|.|||||.|..|....    ::.:.::||
 Worm   260 EEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/230 (23%)
Tryp_SPc 40..256 CDD:238113 53/230 (23%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 53/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.